DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and Clic2

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:233 Identity:77/233 - (33%)
Similarity:118/233 - (50%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PEIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPP 85
            |||||.:||.: ||...|.|.|||..||.|:    ||.:...|||:|..:.|.:.:.....|:||
  Rat    12 PEIELFVKAGS-DGESIGNCPFCQRLFMILW----LKGVKFNVTTIDTARKPEELKDLAPGTNPP 71

  Fly    86 ILIDNGLAILENEKIERHIMKNI-PGGY-NLFVQDKEVATLIENLYVKLKLML--VKKDEAKN-- 144
            .||.|.....:..|||..:.|.: |..| :|..:.||...:..||:.|....:  .:|:..||  
  Rat    72 FLIYNKELKTDFIKIEEFLEKTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFE 136

  Fly   145 NALLSHLRKINDHLSA----------------RNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFV 193
            .:||...::::|:|:.                ....||.||.:...||.|:|:|..|:||.|.:.
  Rat   137 KSLLREFKRLDDYLNTPLLDEIDPDSTEERTLSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYR 201

  Fly   194 DFEIPTHLTALWRYMYHMYQLDAFTQSCPADQDIINHY 231
            ||:||...:.:|||:::.|..:.|..:||.|::|.|.|
  Rat   202 DFDIPAEFSGVWRYLHNAYAREEFAHTCPEDKEIENTY 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 35/91 (38%)
O-ClC 21..231 CDD:129941 76/231 (33%)
GST_C_CLIC 118..232 CDD:198307 40/134 (30%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 34/88 (39%)
GST_N_CLIC 9..99 CDD:239359 35/91 (38%)
O-ClC 12..245 CDD:129941 77/233 (33%)
GST_C_CLIC2 106..244 CDD:198331 40/134 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4688
OMA 1 1.010 - - QHG57946
OrthoDB 1 1.010 - - D541338at33208
OrthoFinder 1 1.000 - - FOG0000394
OrthoInspector 1 1.000 - - otm45221
orthoMCL 1 0.900 - - OOG6_107975
Panther 1 1.100 - - O PTHR43920
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.