DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and CLIC4

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_039234.1 Gene:CLIC4 / 25932 HGNCID:13518 Length:253 Species:Homo sapiens


Alignment Length:242 Identity:74/242 - (30%)
Similarity:120/242 - (49%) Gaps:28/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SQETNGSSKFD-VPEIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPP 72
            |...||..:.| .|.|||.:||.: ||...|.|.|.|..||.|:    ||.:...|||||:::.|
Human     4 SMPLNGLKEEDKEPLIELFVKAGS-DGESIGNCPFSQRLFMILW----LKGVVFSVTTVDLKRKP 63

  Fly    73 PDFRTNFEATHPPILIDNGLAILENEKIERHIMKNI--PGGYNLFVQDKEVATLIENLYVK---- 131
            .|.:.....||||.:..|.....:..|||..:.:.:  |....|..:..|..|...:::.|    
Human    64 ADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAY 128

  Fly   132 LKLMLVKKDEAKNNALLSHLRKINDHLSA----------------RNTRFLTGDTMCCFDCELMP 180
            :|....:.:||....||..|:|::::|::                ...:||.|:.|...||.|:|
Human   129 IKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLP 193

  Fly   181 RLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQLDAFTQSCPADQDI 227
            :|..::|..|.:.:|:||..:|.:|||:.:.|..|.||.:||:|:::
Human   194 KLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 34/96 (35%)
O-ClC 21..231 CDD:129941 70/229 (31%)
GST_C_CLIC 118..232 CDD:198307 36/130 (28%)
CLIC4NP_039234.1 Required for insertion into the membrane. /evidence=ECO:0000305 2..101 36/101 (36%)
O-ClC 17..252 CDD:129941 70/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4781
Isobase 1 0.950 - 0 Normalized mean entropy S6054
OMA 1 1.010 - - QHG57946
OrthoDB 1 1.010 - - D541338at33208
OrthoFinder 1 1.000 - - FOG0000394
OrthoInspector 1 1.000 - - otm41081
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.