DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GSTT4

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:37 Identity:11/37 - (29%)
Similarity:17/37 - (45%) Gaps:2/37 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KGACLFCQEYFMDLYLLAELKTISLK--VTTVDMQKP 71
            |.:....:|||:...:......|||.  |..|:|.:|
Human   141 KNSLQLFEEYFLQDKMFITGNQISLADLVAVVEMMQP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 11/37 (30%)
O-ClC 21..231 CDD:129941 11/37 (30%)
GST_C_CLIC 118..232 CDD:198307
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P30711 53..54
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P30711 66..67
GST_C_Theta 91..217 CDD:198292 11/37 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154369
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.