DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and gsto-3

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_741069.1 Gene:gsto-3 / 175196 WormBaseID:WBGene00019636 Length:309 Species:Caenorhabditis elegans


Alignment Length:132 Identity:31/132 - (23%)
Similarity:50/132 - (37%) Gaps:5/132 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMK 106
            || .|...:.:....|.|.::|..|:..:.|..:.........|.|..||..:.|:..|..::.:
 Worm   106 FC-PYAQRVLIYLAKKNIPVEVVNVNPDRSPNWYLPKSPIGRVPALEINGKVVWESNVIVEYLDE 169

  Fly   107 NIPGGYNLFVQDKEVA---TLIENLYVKLKLMLVKKDEAKNNALLSHLRKINDHLSARNTRFLTG 168
            ..|....|.....|.|   .|:|.| ..:...|.:...:.||........:|.|.:.||:..|..
 Worm   170 LFPTNTILPRDAYEKAHQKILVERL-SPIMNALFEFYGSSNNPQAQRQNDMNVHSALRNSENLLR 233

  Fly   169 DT 170
            ||
 Worm   234 DT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 15/69 (22%)
O-ClC 21..231 CDD:129941 31/132 (23%)
GST_C_CLIC 118..232 CDD:198307 15/56 (27%)
gsto-3NP_741069.1 GST_N_Omega 81..168 CDD:239353 14/62 (23%)
GST_C_Omega 182..308 CDD:198293 15/55 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.