DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and Gstt2

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus


Alignment Length:209 Identity:46/209 - (22%)
Similarity:73/209 - (34%) Gaps:58/209 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EYFMDL--------YLLAELKTISLKVTTVD----------------MQKPPPDFRTNFEATHPP 85
            |.::||        |:.|:...|..:..|||                :.|.|.....:|..|..|
Mouse     4 ELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESP 68

  Fly    86 ILIDNGLAIL-----------------------ENEKIERHIMKNIPGGYNLFVQDKEVATLIEN 127
            ..:....|||                       .:|.:..| ..||.|.:.:.:..|.:..||. 
Mouse    69 SSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWH-ADNIRGTFGVLLWTKVLGPLIG- 131

  Fly   128 LYVKLKLMLVKKDEAKNNALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYF 192
              |::.   .:|.|...:.::..|:::.|.. .|:..||.|..:...|...:..|.. .||..|.
Mouse   132 --VQVP---QEKVERNRDRMVLVLQQLEDKF-LRDRAFLVGQQVTLADLMSLEELMQ-PVALGYN 189

  Fly   193 VDFEIPTHLTALWR 206
            : ||....||| ||
Mouse   190 L-FEGRPQLTA-WR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 22/113 (19%)
O-ClC 21..231 CDD:129941 46/209 (22%)
GST_C_CLIC 118..232 CDD:198307 24/89 (27%)
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 17/80 (21%)
GST_C_Theta 98..223 CDD:198292 29/115 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.