DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GSTD10

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_313668.1 Gene:GSTD10 / 1274530 VectorBaseID:AGAP004383 Length:211 Species:Anopheles gambiae


Alignment Length:199 Identity:37/199 - (18%)
Similarity:74/199 - (37%) Gaps:52/199 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MDLY----------LLAELKTISLKVTTVDMQKPPPDFRTNFEATHP----PILIDNGLAILENE 98
            |:||          :|...|.:.:.....::....|:.|......:|    |..|::|..|.|:.
Mosquito     1 MELYYNIVSPPCQSVLLVGKKLGITFDLKEVNPHLPEVREQLRKFNPQHTIPTFIEDGHVIWESY 65

  Fly    99 KIERHIMKNIPGGYN-LFVQDKEVATLI-ENLYVKLKLM----------LVKKDEAKNNALLSHL 151
            .|..::::....|.: |:.:|.:|.::: :.|:....||          ::||.......:...|
Mosquito    66 AIAIYLVEKYGNGDDALYPRDPKVRSVVNQRLFFDNGLMFKSAIEYVECILKKKLEPTEEMQQRL 130

  Fly   152 RK---------------INDHLSARNTRFLTGDTMCC---FDCELMPRLQH--IRVAGKYFVDFE 196
            :|               .:|||:..:...|:..|:..   :|....|.:..  .||.|      |
Mosquito   131 KKALGLLESFVKERAFVASDHLTIADICLLSSVTLLTGIKYDLATFPGITAWVARVTG------E 189

  Fly   197 IPTH 200
            :|.:
Mosquito   190 LPDY 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 14/77 (18%)
O-ClC 21..231 CDD:129941 37/199 (19%)
GST_C_CLIC 118..232 CDD:198307 21/114 (18%)
GSTD10XP_313668.1 GstA 1..186 CDD:223698 32/184 (17%)
GST_N_Delta_Epsilon 1..73 CDD:239343 14/71 (20%)
GST_C_Delta_Epsilon 88..200 CDD:198287 20/112 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.