DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and GSTO2

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:176 Identity:37/176 - (21%)
Similarity:66/176 - (37%) Gaps:15/176 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMK 106
            || .|.....|:.:.|.|..:|..::::..|..:.|.....|.|:|..:...::....|....:.
Human    31 FC-PYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLD 94

  Fly   107 NIPGGYNLFVQD---KEVATLIENLYVKLK------LMLVKKDEAKNN---ALLSHLRKINDHLS 159
            :...|..||..|   :....::..|:.|:.      |:.::......|   ||......:.:.|.
Human    95 DAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILE 159

  Fly   160 ARNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTHLTALW 205
            .:||.|..|..:...|..|.|..:.:.|.|  .:|....|....||
Human   160 YQNTTFFGGTCISMIDYLLWPWFERLDVYG--ILDCVSHTPALRLW 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 13/69 (19%)
O-ClC 21..231 CDD:129941 37/176 (21%)
GST_C_CLIC 118..232 CDD:198307 21/100 (21%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 13/63 (21%)