DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and CLIC1

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001274522.1 Gene:CLIC1 / 1192 HGNCID:2062 Length:241 Species:Homo sapiens


Alignment Length:241 Identity:61/241 - (25%)
Similarity:111/241 - (46%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PEIELIIKASTIDGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPPDFRTNFEATHPP 85
            |::||.:||.: ||.:.|.|.|.|..||.|:    ||.::..|||||.::.....:........|
Human     6 PQVELFVKAGS-DGAKIGNCPFSQRLFMVLW----LKGVTFNVTTVDTKRRTETVQKLCPGGQLP 65

  Fly    86 ILIDNGLAILENEKIERHIMKNI-PGGY-NLFVQDKEVATLIENLYVKLKLMLVKKDEAKNN--- 145
            .|:.......:..|||..:...: |..| .|...:.|..|...:::.|....:...:.|.|:   
Human    66 FLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLE 130

  Fly   146 -ALLSHLRKINDHLSA----------------RNTRFLTGDTMCCFDCELMPRLQHIRVAGKYFV 193
             .||..|:.::::|::                ...:||.|:.:...||.|:|:|..::|..|.:.
Human   131 KGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYR 195

  Fly   194 DFEIPTHLTALWRYMYHMYQLDAFTQSCPADQDI-INHYKLQQSLK 238
            .|.||.....:.||:.:.|..:.|..:||.|::| :.:.::.::||
Human   196 GFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 27/91 (30%)
O-ClC 21..231 CDD:129941 59/232 (25%)
GST_C_CLIC 118..232 CDD:198307 30/134 (22%)
CLIC1NP_001274522.1 Required for insertion into the membrane 2..90 26/88 (30%)
O-ClC 6..241 CDD:129941 59/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4781
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57946
OrthoDB 1 1.010 - - D541338at33208
OrthoFinder 1 1.000 - - FOG0000394
OrthoInspector 1 1.000 - - otm41081
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.