DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and pcsk6

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_017947964.1 Gene:pcsk6 / 100485543 XenbaseID:XB-GENE-979058 Length:917 Species:Xenopus tropicalis


Alignment Length:39 Identity:13/39 - (33%)
Similarity:18/39 - (46%) Gaps:6/39 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKP 71
            :|.|:|....|..|...:|      |||:..||.:..||
 Frog   302 NGGREGDYCSCDGYTNSIY------TISISSTTENGYKP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 13/39 (33%)
O-ClC 21..231 CDD:129941 13/39 (33%)
GST_C_CLIC 118..232 CDD:198307
pcsk6XP_017947964.1 S8_pro-domain 28..104 CDD:374560
Peptidases_S8_Protein_convertases_Kexins_Fur in-lik 115..409 CDD:173789 13/39 (33%)
P_proprotein 500..590 CDD:366670
GF_recep_IV 642..761 CDD:373332
FU 743..785 CDD:214589
FU 792..834 CDD:214589
Furin-like_2 798..880 CDD:374219
PLAC 890..913 CDD:370061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165172555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.