powered by:
Protein Alignment Clic and pcsk6
DIOPT Version :9
Sequence 1: | NP_001259537.2 |
Gene: | Clic / 32349 |
FlyBaseID: | FBgn0030529 |
Length: | 260 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017947964.1 |
Gene: | pcsk6 / 100485543 |
XenbaseID: | XB-GENE-979058 |
Length: | 917 |
Species: | Xenopus tropicalis |
Alignment Length: | 39 |
Identity: | 13/39 - (33%) |
Similarity: | 18/39 - (46%) |
Gaps: | 6/39 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 DGRRKGACLFCQEYFMDLYLLAELKTISLKVTTVDMQKP 71
:|.|:|....|..|...:| |||:..||.:..||
Frog 302 NGGREGDYCSCDGYTNSIY------TISISSTTENGYKP 334
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165172555 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.