DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clic and gstz1

DIOPT Version :9

Sequence 1:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:102 Identity:26/102 - (25%)
Similarity:46/102 - (45%) Gaps:9/102 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 IENLYVKLKLMLVKKDEAKNNALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQHIRVAG 189
            ::||.|..|:...|.:.|| :.:....:.:...|.....|:..||.:...|..|:|::.:   |.
 Frog   114 LQNLCVLQKIGETKLEWAK-HFITRGFQALEKLLQTTAGRYCVGDEVTIADLCLVPQVAN---AV 174

  Fly   190 KYFVDF-EIPTHLTALWRYMYHMYQLDAFTQSCPADQ 225
            ::.||. ..||    :......:.||:||..|.|:.|
 Frog   175 RFKVDLAPYPT----IVGINESLLQLEAFQVSHPSCQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359
O-ClC 21..231 CDD:129941 26/102 (25%)
GST_C_CLIC 118..232 CDD:198307 26/102 (25%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 26/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.