DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and NUDT21

DIOPT Version :10

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_177495.2 Gene:NUDT21 / 843688 AraportID:AT1G73540 Length:198 Species:Arabidopsis thaliana


Alignment Length:101 Identity:24/101 - (23%)
Similarity:34/101 - (33%) Gaps:45/101 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 DSSYVDCALRETEEEIGLPRHRIQVWGEAKQLQLPRTSSIVPVVGVVPDFSLSELRLNWEEVEEA 192
            |.|..:.|||||.||.|       |.|:.::                   ||.:    |:.    
plant   103 DESIEEAALRETIEEAG-------VTGQLEE-------------------SLGK----WQY---- 133

  Fly   193 FSVPLTSLMLPKATRHTQFRSGYSGPVFVVDHYRIW 228
                       |:.|||....|:..|:.|...:.||
plant   134 -----------KSKRHTMIHDGHMFPLLVSQQFEIW 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 NUDIX_CoAse_Nudt7 84..238 CDD:467532 24/101 (24%)
NUDT21NP_177495.2 NUDIX_DIPP2_like_Nudt4 62..190 CDD:467551 24/101 (24%)

Return to query results.
Submit another query.