DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and NUDX15

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001031104.1 Gene:NUDX15 / 839773 AraportID:AT1G28960 Length:293 Species:Arabidopsis thaliana


Alignment Length:299 Identity:73/299 - (24%)
Similarity:121/299 - (40%) Gaps:55/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ASRTVPQLLLHLNRHLVTSCSSAASATSS-------------KPPDVDQSITADQLLGPESQRRC 58
            |..|...||.......:|:.||::....|             |||.......::::   ::.:..
plant    12 ARTTTTTLLCKSMEPAITATSSSSFGGGSSRLAALAQQLRQYKPPPSSSFDDSEEM---QTDQET 73

  Fly    59 MEKMRSLPAFPR---PKALTPSRREKQTSAVLIALCQERGTNEISLLYTRRSRHLRSHSFQISFP 120
            ..|:.|...|..   |.:..|.|.:.:.:||||.|. |....::.::.|:||..|.:||.::|.|
plant    74 AGKVVSQVGFQESIAPLSKDPDRFKPKRAAVLICLF-EGDDGDLRVILTKRSSKLSTHSGEVSLP 137

  Fly   121 GGRRDDHDSSYVDCALRETEEEIGLPRHRIQVWGEAKQLQLPRTSSIVPVVGVVPDFSLSELRLN 185
            ||:.::.|......|.||.||||||....:.|....:.........::||:|::.|.:......|
plant   138 GGKAEEDDKDDGMTATREAEEEIGLDPSLVDVVTSLEPFLSKHLLRVIPVIGILRDKNKFNPIPN 202

  Fly   186 WEEVEEAFSVPLTSLMLPKATRHTQFRSGYSGPVFVVDH---------YRIWGITGYLTHLFLHC 241
            ..|||..|..|| .:.|....|.::.|. :.|..:::.:         |.|||:|..:       
plant   203 PGEVEAVFDAPL-EMFLKDENRRSEERE-WMGEKYLIHYFDYRTGDKDYMIWGLTAGI------- 258

  Fly   242 LL---------PPNLLPDCLKTNIKFIRPFKLPPKLPHH 271
            |:         ||..:..|.|        ||.|..:..|
plant   259 LIRAASVTYERPPAFIEQCPK--------FKYPKMVEKH 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 47/162 (29%)
NUDX15NP_001031104.1 Nudix_Hydrolase 97..280 CDD:294304 52/200 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I3191
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2401
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253012at2759
OrthoFinder 1 1.000 - - FOG0001407
OrthoInspector 1 1.000 - - otm3258
orthoMCL 1 0.900 - - OOG6_101045
Panther 1 1.100 - - O PTHR12992
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.