DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and NUDT22

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001325146.1 Gene:NUDT22 / 817959 AraportID:AT2G33980 Length:319 Species:Arabidopsis thaliana


Alignment Length:265 Identity:69/265 - (26%)
Similarity:109/265 - (41%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SCSSAASATSS-------------------KPPDVDQSITADQLLGPESQRRCMEKMRSLPAFPR 70
            |.:||||.|:.                   |||........::||..:...|     :|:.....
plant     3 SGASAASPTAKSFNFGSSRLLALAQQLRVYKPPLSSSFDEREELLAYKESTR-----KSITHVGF 62

  Fly    71 PKALTPSRREKQTSAVLIALCQERGTNEISLLYTRRSRHLRSHSFQISFPGGRRDDHDSSYVDCA 135
            .:::.|.|...:.:||||.|. |....::.::.|:||..|.:||.::|.|||:.::||......|
plant    63 QESMAPVRFRPKKAAVLICLF-EGDDGDLRVILTKRSSTLSTHSGEVSLPGGKAEEHDKDDGITA 126

  Fly   136 LRETEEEIGLPRHRIQVWGEAKQLQLPRTSSIVPVVGVVPDFSLSELRLNWEEVEEAFSVPLTSL 200
            .||.||||||....:.|....:.........::||||::.|........|..|||.....|....
plant   127 TREAEEEIGLDPSLVDVVAFLEPFLSQHLLRVIPVVGILWDRKAFNPTPNPAEVEAVLDAPFEMF 191

  Fly   201 MLPKATRHTQFR-SGYSGPVFVVDH------YRIWGITGYL-----THLFLHCLLPPNLLPDCLK 253
            :..:..|..:|. .|....|...|:      |.|||:|..:     |.::..   ||..:..  |
plant   192 LKDENRRSEEFDWMGEKHLVHFFDYKTGDSDYVIWGLTARILIRAATVVYQR---PPAFIEQ--K 251

  Fly   254 TNIKF 258
            .|:|:
plant   252 PNLKY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 49/165 (30%)
NUDT22NP_001325146.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I3191
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2401
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253012at2759
OrthoFinder 1 1.000 - - FOG0001407
OrthoInspector 1 1.000 - - otm3258
orthoMCL 1 0.900 - - OOG6_101045
Panther 1 1.100 - - O PTHR12992
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.