DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and nudt8

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_021337150.1 Gene:nudt8 / 791929 ZFINID:ZDB-GENE-061013-219 Length:298 Species:Danio rerio


Alignment Length:162 Identity:51/162 - (31%)
Similarity:77/162 - (47%) Gaps:20/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LNRHLVTSCSSAASATSSKPP-------DVDQSITADQLLGPESQRRCMEKMRSLPAFPRPKALT 75
            ||:....|.|:......|:|.       .:.::...::.:...::.||   .|||.|    .|..
Zfish   114 LNQQSCVSISAGHVCAESRPAVFAIQRRRLHRNAQFEECVSALNEARC---RRSLQA----NAAL 171

  Fly    76 PSRREKQTSAVLIALCQERGTNEISLLYTRRSRHLRS-HSFQISFPGGRRDDHDSSYVDCALRET 139
            ..|...:.:|||:.||..||  :.:||:|.||..|:. |...:||.||::|..|.:.||.||||.
Zfish   172 YERDTHRWAAVLVCLCVSRG--DPALLFTLRSAQLKGRHKGDVSFAGGKKDPSDRTVVDTALREA 234

  Fly   140 EEEIGLPRHRIQVWGEAKQLQLPRTSSIVPVV 171
            .||:|:.....:|||..|.|   |...:.|.|
Zfish   235 AEELGIHIPEEKVWGVLKPL---RDKCVSPTV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 37/89 (42%)
nudt8XP_021337150.1 CoAse 178..>264 CDD:239518 37/91 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595076
Domainoid 1 1.000 74 1.000 Domainoid score I9095
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41633
Inparanoid 1 1.050 103 1.000 Inparanoid score I4949
OMA 1 1.010 - - QHG52532
OrthoDB 1 1.010 - - D1253012at2759
OrthoFinder 1 1.000 - - FOG0001407
OrthoInspector 1 1.000 - - oto39456
orthoMCL 1 0.900 - - OOG6_101045
Panther 1 1.100 - - LDO PTHR12992
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1771
SonicParanoid 1 1.000 - - X6507
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.