DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and Nudt11

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_003752064.1 Gene:Nudt11 / 680248 RGDID:1594183 Length:164 Species:Rattus norvegicus


Alignment Length:88 Identity:21/88 - (23%)
Similarity:38/88 - (43%) Gaps:19/88 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 PGGRRDDHDSSYVDCALRETEEEIGLPRHRIQVWGEAKQLQLPRTSSIVPVVGVVPDFSLSELRL 184
            |||..:..:.. ...|:||..||.|:.....::.|..:|.|..:..:.|.|:      :::||..
  Rat    48 PGGGMEPEEEP-DGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVFVL------TVTELLE 105

  Fly   185 NWEE------------VEEAFSV 195
            :||:            :|:|..|
  Rat   106 DWEDSVSIGRKREWFKIEDAIKV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 21/88 (24%)
Nudt11XP_003752064.1 Nudix_Hydrolase_9 18..137 CDD:240024 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.