DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and Nudt8

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_079805.1 Gene:Nudt8 / 66387 MGIID:1913637 Length:210 Species:Mus musculus


Alignment Length:232 Identity:79/232 - (34%)
Similarity:113/232 - (48%) Gaps:41/232 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LGPESQRRCME-------KMRSLPAFPRPKALTPSRREKQTSAVLIALCQERGTNEISLLYT-RR 106
            |..|.::||.:       ::||.||               .:|||:.||..||..  :|||| |.
Mouse     6 LSAEDEQRCRQLLARTTARLRSRPA---------------AAAVLVPLCLVRGVP--ALLYTLRS 53

  Fly   107 SRHLRSHSFQISFPGGRRDDHDSSYVDCALRETEEEIGLPRHRIQVWGEAKQLQLPRTSSIVPVV 171
            ||.:..|..::|||||:.|..|...:..|||||:||:||...:..|||..:.:.....::||||:
Mouse    54 SRLVGRHKGEVSFPGGKCDPDDQDVIHTALRETQEELGLEVPKEHVWGVLQPVYDREKATIVPVL 118

  Fly   172 GVVPDFSLSELRLNWEEVEEAFSVPLTSLMLPKATRHTQFRSG----YSGPVFVVDHYRIWGITG 232
            ..|....|..||.|.|||:|.|.:.|..|:..:...:|.|..|    |:.|||:...:|:||:|.
Mouse   119 ANVGPLDLQSLRPNLEEVDEVFEMSLAHLLQTQNQGYTHFCQGGHFSYTLPVFLHGPHRVWGLTA 183

  Fly   233 YLTHLFLHCLLPPNLLPDCLKTNIKFIRPFKLPPKLP 269
            .:|.|.|..|.|            .|.:|....|:||
Mouse   184 VITELTLKLLAP------------GFYQPSLAVPELP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 62/158 (39%)
Nudt8NP_079805.1 CoAse 31..186 CDD:239518 61/156 (39%)
Nudix box 70..91 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849444
Domainoid 1 1.000 76 1.000 Domainoid score I8994
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41633
Inparanoid 1 1.050 111 1.000 Inparanoid score I4865
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52532
OrthoDB 1 1.010 - - D1253012at2759
OrthoFinder 1 1.000 - - FOG0001407
OrthoInspector 1 1.000 - - oto93960
orthoMCL 1 0.900 - - OOG6_101045
Panther 1 1.100 - - LDO PTHR12992
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1771
SonicParanoid 1 1.000 - - X6507
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.