powered by:
Protein Alignment CG11095 and Nudt14
DIOPT Version :9
Sequence 1: | NP_572927.1 |
Gene: | CG11095 / 32348 |
FlyBaseID: | FBgn0030528 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_079675.1 |
Gene: | Nudt14 / 66174 |
MGIID: | 1913424 |
Length: | 222 |
Species: | Mus musculus |
Alignment Length: | 42 |
Identity: | 13/42 - (30%) |
Similarity: | 21/42 - (50%) |
Gaps: | 8/42 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 155 EAKQLQ--LPRTSSIVP--VVGVV--PDFSLSELRLN--WEE 188
:.::|| ||.::.::. ..|:| |..||.|.... |||
Mouse 85 QPQELQQALPGSAGVMVELCAGIVDQPGLSLEEAACKEAWEE 126
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.