DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and Nudt14

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_079675.1 Gene:Nudt14 / 66174 MGIID:1913424 Length:222 Species:Mus musculus


Alignment Length:42 Identity:13/42 - (30%)
Similarity:21/42 - (50%) Gaps:8/42 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 EAKQLQ--LPRTSSIVP--VVGVV--PDFSLSELRLN--WEE 188
            :.::||  ||.::.::.  ..|:|  |..||.|....  |||
Mouse    85 QPQELQQALPGSAGVMVELCAGIVDQPGLSLEEAACKEAWEE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 13/42 (31%)
Nudt14NP_079675.1 TIGR00052 17..210 CDD:129162 13/42 (31%)
Nudix box 111..129 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.