DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11095 and NUDT11

DIOPT Version :9

Sequence 1:	NP_572927.1	Gene:	CG11095 / 32348	FlyBaseID:	FBgn0030528	Length:	283	Species:	Drosophila melanogaster
Sequence 2:	NP_060629.2	Gene:	NUDT11 / 55190	HGNCID:	18011	Length:	164	Species:	Homo sapiens

Alignment Length:	88	Identity:	22/88 - (25%)
Similarity:	38/88 - (43%)	Gaps:	19/88 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   120 PGGRRDDHDSSYVDCALRETEEEIGLPRHRIQVWGEAKQLQLPRTSSIVPVVGVVPDFSLSELRL 184
            |||..:..:.. ...|:||..||.|:.....::.|..:|.|..:..:.|.|:      :::||..
Human    48 PGGGMEPEEEP-GGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVL------TVTELLE 105

  Fly   185 NWEE------------VEEAFSV 195
            :||:            ||:|..|
Human   106 DWEDSVSIGRKREWFKVEDAIKV 128

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11095	NP_572927.1	CoAse	84..238	CDD:239518	22/88 (25%)
NUDT11	NP_060629.2	Substrate binding. /evidence=ECO:0000250\|UniProtKB:O95989	17..19
		Nudix_Hydrolase_9	18..137	CDD:240024	22/88 (25%)
		Substrate binding. /evidence=ECO:0000250\|UniProtKB:O95989	38..40
		Nudix box	50..71		6/21 (29%)
		Substrate binding. /evidence=ECO:0000250\|UniProtKB:O95989	89..91		0/1 (0%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	144..164
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0494
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900