DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and Nudt5

DIOPT Version :10

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_036018286.1 Gene:Nudt5 / 53893 MGIID:1858232 Length:264 Species:Mus musculus


Alignment Length:90 Identity:22/90 - (24%)
Similarity:38/90 - (42%) Gaps:17/90 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 FLACNTLALVVNFIENFTEPSPVLLNFLSDTSNFLVVFNSSVNCIIYFIFNTDYRDVFLIYWKKL 343
            |:...||.|::..:||         ..|...|..|||.|:.|:....:.:|...::.....:|.:
Mouse     3 FIPTVTLVLLLRSLEN---------KILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGV 58

  Fly   344 KRVLIEEYCCCCVPAGSRNYSAYQP 368
            ...:  |.|     .|:.|:: |||
Mouse    59 NSDV--EVC-----VGNGNFT-YQP 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 NUDIX_CoAse_Nudt7 84..238 CDD:467532
Nudt5XP_036018286.1 NUDIX_ADPRase_Nudt5 104..250 CDD:467598
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.