DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and NUDT19

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001099040.1 Gene:NUDT19 / 390916 HGNCID:32036 Length:375 Species:Homo sapiens


Alignment Length:255 Identity:52/255 - (20%)
Similarity:82/255 - (32%) Gaps:87/255 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GPESQRRCMEKMRSLPAFPRPKALTPSRREKQTSAVLIALCQ----------------------E 93
            ||...||....:.: ..:.||:..||..|........:.|.|                      :
Human     8 GPSRWRRAASIVLA-AGWSRPETATPPSRPPPAEGFRLLLLQRSPHQGFMPGAHVFSGGVLDAAD 71

  Fly    94 RGTNEISLLYTRRSRHLRSHSF--------QISFPG-GRRDDH----------DSSYVDCALRET 139
            |..:.:.|.    :.|.....|        :.:||. ...|||          |.::..||:||.
Human    72 RSADWLGLF----APHHGPPRFGLGPAPFSRTAFPSLPDTDDHKTDNTGTLPEDVAFRICAVREA 132

  Fly   140 EEEIGLPRHRIQVWGEAKQLQLPRTSSIVPVVGVVPDFSLSEL--RLNWEEVEEAFSVPLTSLML 202
            .||.|:            .|..||||...|..|  |..:|...  ..:|.:            .:
Human   133 FEEAGV------------LLLRPRTSPPGPAPG--PGLALEPPPGLASWRD------------RV 171

  Fly   203 PKATRHTQFRSGY---SGPVFVVDHYRIWGITGYL--------THLFLHCLL-PPNLLPD 250
            .:..||......:   :..::.:.::..| :|.:|        |..||.||. ||.:.||
Human   172 RQDPRHFLRLCAHLDCTPDIWALHNWSAW-LTPFLRGTTRRFDTAFFLCCLREPPPVYPD 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 35/207 (17%)
NUDT19NP_001099040.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..116 5/24 (21%)
Nudix box 116..137 7/20 (35%)
Microbody targeting signal. /evidence=ECO:0000255 373..375
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.