DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and Nudt8

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_008758411.1 Gene:Nudt8 / 361692 RGDID:1309040 Length:225 Species:Rattus norvegicus


Alignment Length:247 Identity:80/247 - (32%)
Similarity:113/247 - (45%) Gaps:56/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LGPESQRRCME-------KMRSLPAFPRPKALTPSRREKQTSAVLIALCQERGTNEISLLYT-RR 106
            |..|.::||.:       .:||.||               .:|||:.||..||..  :|||| |.
  Rat     6 LSAEDEQRCRQLLARTTAGLRSRPA---------------AAAVLVPLCLVRGVP--ALLYTLRS 53

  Fly   107 SRHLRSHSFQISFPGGRRDDHDSSYVDCALRETEEEIGLPRHRIQVWGEAKQL------------ 159
            ||.:..|..::|||||:.|..|...:..|||||:||:||...:..|||..:.:            
  Rat    54 SRLVGRHKGEVSFPGGKCDPGDQDVIHTALRETQEELGLEVSKEHVWGVLQPVYDRVSHPHPVTP 118

  Fly   160 QLP---RTSSIVPVVGVVPDFSLSELRLNWEEVEEAFSVPLTSLMLPKATRHTQFRSG----YSG 217
            ..|   |.::||||:..|....|..||.|.|||:|.|.:.|..|:..:...:|.|..|    |:.
  Rat   119 STPGDRRKATIVPVLANVGPLDLQSLRPNPEEVDEVFELSLAHLLQTQNQGYTHFCQGGHFCYTL 183

  Fly   218 PVFVVDHYRIWGITGYLTHLFLHCLLPPNLLPDCLKTNIKFIRPFKLPPKLP 269
            |||:...:|:|||:..:|.|.|..|.|            ...:|....|:||
  Rat   184 PVFLHGPHRVWGISAVITELTLKLLAP------------GIYQPSLAVPELP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 64/173 (37%)
Nudt8XP_008758411.1 CoAse 31..201 CDD:239518 63/171 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353074
Domainoid 1 1.000 77 1.000 Domainoid score I8698
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41633
Inparanoid 1 1.050 111 1.000 Inparanoid score I4784
OMA 1 1.010 - - QHG52532
OrthoDB 1 1.010 - - D1253012at2759
OrthoFinder 1 1.000 - - FOG0001407
OrthoInspector 1 1.000 - - oto97492
orthoMCL 1 0.900 - - OOG6_101045
Panther 1 1.100 - - LDO PTHR12992
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6507
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.