DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and Nudt7

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_038953791.1 Gene:Nudt7 / 361413 RGDID:1306719 Length:285 Species:Rattus norvegicus


Alignment Length:284 Identity:73/284 - (25%)
Similarity:114/284 - (40%) Gaps:78/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SCSSAASATSSKPPDVDQSITADQLLGPESQRRCMEKMRSLPAFPRPKALTPSRREKQTSAVLIA 89
            :|....:....:|..:.:|: .:.|:.....|     ::......|...|:||:     .:||:.
  Rat    16 ACRKGTAGPMPRPCGLQESV-RNNLIDDAKAR-----LKKFDVGTRYSHLSPSK-----YSVLLP 69

  Fly    90 LCQERGTNEISLLYTRRSRHLRSHSFQISFPGGRRDDHDSSYVDCALRETEEEIGLPRHRIQVWG 154
            |. .|| .::.||:|.||..||....::.||||:||..|:.....||||.:||:||..|:::|..
  Rat    70 LL-ARG-EKLYLLFTVRSDKLRRAPGEVCFPGGKRDPVDADDTATALREAQEEVGLHPHQVEVVS 132

  Fly   155 E-------------------------AKQLQLPRTSSIVPVVGVV-PDFSLSELRLNWEEVEEAF 193
            .                         ..|.:......:.||||.: |||   :.:.|.:||::.|
  Rat   133 HLVPYFINKYALSNIVPFSVDVTSFPCPQQEERNNDLVTPVVGFLDPDF---QAQPNADEVKDVF 194

  Fly   194 SVPLTSLMLPKATRHTQF-RSGYSGPVFVV-----------DHYRIWGITGYL------------ 234
            .|||...:.|:....:.| .|||.   ||:           ..|.|.|:|..|            
  Rat   195 LVPLDYFLCPQVYYQSHFTHSGYH---FVLHCFEYTDPETGSKYLIKGMTSKLAVLAALIIFEKS 256

  Fly   235 ----THLFLHCLLPPNLLPDCLKT 254
                |...||     :|:|.|.||
  Rat   257 PSFETEFDLH-----DLIPSCEKT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 57/207 (28%)
Nudt7XP_038953791.1 CoAse 65..241 CDD:239518 54/183 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253012at2759
OrthoFinder 1 1.000 - - FOG0001407
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101045
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.