DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and Nudt5

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001007734.1 Gene:Nudt5 / 361274 RGDID:1359284 Length:219 Species:Rattus norvegicus


Alignment Length:124 Identity:30/124 - (24%)
Similarity:51/124 - (41%) Gaps:28/124 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SKPPDVDQSITADQLLG--------------PESQRRCMEKMRSLPAFPRPKALTPSRREKQTSA 85
            |.|| .:|.|.:::|:.              |..:.|..|.::          || :|:.|...|
  Rat     9 SSPP-TEQRILSEELISEGKWVKFEKTTYMDPTGKTRTWETVK----------LT-TRKGKSADA 61

  Fly    86 VLIALCQERGTNEISLLYTRRSRHLRSHSFQISFPGGRRDDHDSSYVDCALRETEEEIG 144
            |.:....:|..:...::..::.|.... .:.:.||.|..:|.:|... .||||.|||.|
  Rat    62 VSVIPVLQRTLHHECIVLVKQFRPPMG-GYCLEFPAGLIEDGESPEA-AALRELEEETG 118

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 17/61 (28%)