DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and CG10194

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster


Alignment Length:122 Identity:30/122 - (24%)
Similarity:42/122 - (34%) Gaps:54/122 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LTPSRREKQTSAVLIALCQ-ERGT----NEISLLYTRRSRHLRSHSFQISFPGGRRDDHDSS--- 130
            |.|..| ..:|.:|:|..| |:.|    |.:.|..|::|..:...|.   ||||..|..|||   
  Fly     4 LLPKIR-SSSSLILLAKNQVEKSTSCDYNALLLTRTQKSTFMPESSV---FPGGVCDASDSSPAW 64

  Fly   131 -----------------------------------YVD-------CALRETEEEIGL 145
                                               .:|       .|:|||.||:|:
  Fly    65 LEHFQRNEFSAAKLRNVGHVKGPRPDIFHTKADKKSLDPSLALRLTAIRETFEELGI 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 27/112 (24%)
CG10194NP_609973.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.