DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and NUDT7

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001099133.1 Gene:NUDT7 / 283927 HGNCID:8054 Length:238 Species:Homo sapiens


Alignment Length:169 Identity:54/169 - (31%)
Similarity:84/169 - (49%) Gaps:15/169 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 AVLIALCQERGTNEISLLYTRRSRHLRSHSFQISFPGGRRDDHDSSYVDCALRETEEEIGLPRHR 149
            :||:.|..:.|  ::.||:|.||..||....::.||||:||..|......||||.:||:||..|:
Human    41 SVLLPLVAKEG--KLHLLFTVRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQ 103

  Fly   150 IQVWGEAKQLQLPRTSSIVPVVGVVPDFSLSELRLNWEEVEEAFSVPLTSLMLPKA-TRHTQFRS 213
            ::|........:...:.|.|.||:: |.:. :.:.|..||::.|.|||...:.|:. .:|...|.
Human   104 VEVVCCLVPCLIDTDTLITPFVGLI-DHNF-QAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRL 166

  Fly   214 G---------YSGPVFVVDHYRIWGITGYLTHLFLHCLL 243
            |         |:.|...|. |:|.|:|..|..|....:|
Human   167 GHRFINHIFEYTNPEDGVT-YQIKGMTANLAVLVAFIIL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 52/162 (32%)
NUDT7NP_001099133.1 CoAse 41..201 CDD:239518 53/164 (32%)
Nudix box 77..98 9/20 (45%)
Microbody targeting signal. /evidence=ECO:0000250 236..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4648
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253012at2759
OrthoFinder 1 1.000 - - FOG0001407
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101045
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1771
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.