DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and NUDT8

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001230679.1 Gene:NUDT8 / 254552 HGNCID:8055 Length:236 Species:Homo sapiens


Alignment Length:212 Identity:74/212 - (34%)
Similarity:104/212 - (49%) Gaps:29/212 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LGPESQRRCME-------KMRSLPAFPRPKALTPSRREKQTSAVLIALCQERGTNEISLLYTRRS 107
            |..|.:.||..       ::|:.||               ::|||:.||..||..  :||||.||
Human     6 LSAEGELRCRRLLAGATARLRARPA---------------SAAVLVPLCSVRGVP--ALLYTLRS 53

  Fly   108 RHLRS-HSFQISFPGGRRDDHDSSYVDCALRETEEEIGLPRHRIQVWGEAKQLQLPRTSSIVPVV 171
            ..|.. |...:|||||:.|..|...|..|||||.||:||......|||..:.:..|:.:::|||:
Human    54 SRLTGRHKGDVSFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVL 118

  Fly   172 GVVPDFSLSELRLNWEEVEEAFSVPLTSLMLPKATRHTQFRSG----YSGPVFVVDHYRIWGITG 232
            ..|.......||.|.|||:|.|::||..|:..:...:|.|..|    |:.|||:...:|:||:|.
Human   119 AGVGPLDPQSLRPNSEEVDEVFALPLAHLLQTQNQGYTHFCRGGHFRYTLPVFLHGPHRVWGLTA 183

  Fly   233 YLTHLFLHCLLPPNLLP 249
            .:|...|..|.|....|
Human   184 VITEFALQLLAPGTYQP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 63/158 (40%)
NUDT8NP_001230679.1 CoAse 32..186 CDD:239518 62/155 (40%)
Nudix box 70..91 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8114
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41633
Inparanoid 1 1.050 112 1.000 Inparanoid score I4867
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52532
OrthoDB 1 1.010 - - D1253012at2759
OrthoFinder 1 1.000 - - FOG0001407
OrthoInspector 1 1.000 - - oto90376
orthoMCL 1 0.900 - - OOG6_101045
Panther 1 1.100 - - LDO PTHR12992
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1771
SonicParanoid 1 1.000 - - X6507
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.