DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and ndx-8

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_493372.1 Gene:ndx-8 / 190780 WormBaseID:WBGene00003585 Length:234 Species:Caenorhabditis elegans


Alignment Length:168 Identity:47/168 - (27%)
Similarity:77/168 - (45%) Gaps:28/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PSRREKQTSAVLIALCQERGTNEISLLYTRRSRHLRSHSFQISFPGGRRDDHDSSYV-DCALRET 139
            |::.:.:..|.::.|..:.|:.::.:|...|||.||.|..::.||||..||.|...| ..|:||.
 Worm    21 PTKSQGEQDAGVLILLHDDGSEKLKVLLCVRSRQLRRHPGEVCFPGGMMDDEDGQNVRRTAIREA 85

  Fly   140 EEEIGLPRH-RIQVWGEAKQLQLPRTSSIVPVVGVV---PDFSLSELRLNWEEVEEAFSVPLTSL 200
            .||:|:..: ...|.|.....:......|.|.|.::   |.|.||     ..|||..|.:||:..
 Worm    86 YEEVGVNENDDYLVLGNLPAFRARFGVLIHPTVALLRRPPTFVLS-----IGEVESIFWIPLSQF 145

  Fly   201 MLPKATRHTQFRSGYSGPVFVVDHYRIWGITGYLTHLF 238
            :  :.|.|:         .|::|.:       |:.|:|
 Worm   146 L--EDTHHS---------TFLIDEF-------YMVHVF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 45/158 (28%)
ndx-8NP_493372.1 CoAse 28..182 CDD:239518 46/161 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166657
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4648
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253012at2759
OrthoFinder 1 1.000 - - FOG0001407
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101045
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1771
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.630

Return to query results.
Submit another query.