DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and C50F4.16

DIOPT Version :10

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_505461.1 Gene:C50F4.16 / 179337 WormBaseID:WBGene00008238 Length:450 Species:Caenorhabditis elegans


Alignment Length:161 Identity:36/161 - (22%)
Similarity:57/161 - (35%) Gaps:57/161 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RETEEEIGLPRHRIQVWGE----AKQLQLPRTSSIVPVVGVVPDFS-------LSELRLNWEEVE 190
            |..:|.||.|...|.....    |..|:|        ||..||||.       :|..:|.::..|
 Worm   312 RFLKENIGKPLDEIDFSNSDPKIAYTLEL--------VVNRVPDFDDPRKFARISVKQLGYDLPE 368

  Fly   191 EAFSVPLTSLMLPKATRHTQFRSGYSGPVFVVD--HYRIWGITGYLTHLFLHCLLPPNLLPDCLK 253
            ::|.  |.:..:|...     :||.:..:|.||  ..|:                       |.|
 Worm   369 DSFK--LQAKCIPGIG-----QSGDTQSIFAVDVSKARL-----------------------CEK 403

  Fly   254 TNIKFIRPFKLP----PKLPHHREHSAGDPS 280
            ...:.|...::.    |.|  :|:|:.|.|:
 Worm   404 EEDEDIEELRVSFADLPSL--YRQHNIGPPT 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 NUDIX_CoAse_Nudt7 84..238 CDD:467532 27/113 (24%)
C50F4.16NP_505461.1 NUDIX_UGPPase_Nudt14 27..215 CDD:467597
NUDIX_Hydrolase 266..>396 CDD:469772 26/98 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.