DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and NUDT5

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_054861.2 Gene:NUDT5 / 11164 HGNCID:8052 Length:219 Species:Homo sapiens


Alignment Length:193 Identity:40/193 - (20%)
Similarity:76/193 - (39%) Gaps:42/193 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SSKPPDVDQS----ITADQLLGPESQRRCMEKMRSLPAFPRPKALT------PSRREKQTSAVLI 88
            |.:|.:..|:    |.:::|:   |:.:.::..::....|..|..|      .:|:|:....|.:
Human     3 SQEPTESSQNGKQYIISEELI---SEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAV 64

  Fly    89 ALCQERGTNEISLLYTRRSRHLRSHSFQISFPGGRRDDHDSSYVDCALRETEEEIGLPRHRIQVW 153
            ....:|..:...::..::.|.... .:.|.||.|..||.::... .||||.|||.|..       
Human    65 IPVLQRTLHYECIVLVKQFRPPMG-GYCIEFPAGLIDDGETPEA-AALRELEEETGYK------- 120

  Fly   154 GEAKQLQLPRTSSIVPVVGVVPDFS-----LSELRLNWEEVEEAFSVP-------LTSLMLPK 204
            |:..:..        |.|.:.|..|     :..:.:|.::.|.|...|       :..:.|||
Human   121 GDIAECS--------PAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPK 175

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 29/133 (22%)