DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and CG42814

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001189301.1 Gene:CG42814 / 10178958 FlyBaseID:FBgn0261996 Length:237 Species:Drosophila melanogaster


Alignment Length:219 Identity:48/219 - (21%)
Similarity:76/219 - (34%) Gaps:76/219 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLHLNRHLVTSCSSAASATSSKPPDVDQSITADQLLGPESQRRCMEKMRSLPAF-PRPKA---LT 75
            :|.|...|..||.|:|.:                  |.:.|..|:.|:    .| |.||.   :.
  Fly     1 MLRLLGSLGRSCCSSAKS------------------GFKIQPSCISKI----WFGPMPKDSNWIK 43

  Fly    76 PSRR-------EKQTSAV-----LIALCQERGTNEISLLYTRRSRHLRSHSFQISFPGGRRDDHD 128
            |.|.       |||...:     ::.:...:...::..:     |..|...:|.....|   ..|
  Fly    44 PGRLHYIENDVEKQVDIIKTIDGVVVILYNKAREKLIFV-----RQFRGAVYQGIHSAG---SPD 100

  Fly   129 SSYVDCALRETEEEIGLPRHRIQVWGEAKQLQLPRTSSIVPVVGVVPDFSLSELRLNWEEVEE-- 191
            .|..:..|.:...|:|:   .:::.|.|                |..|.||:|:..  |||.|  
  Fly   101 MSKGEADLEQFPPEVGV---TLELCGGA----------------VDKDKSLAEIAK--EEVLEEC 144

  Fly   192 AFSVPLTSLMLPKATRHT-QFRSG 214
            .:.||..||      :|. .:|||
  Fly   145 GYEVPTESL------QHVYDYRSG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 28/139 (20%)
CG42814NP_001189301.1 ADPRase_NUDT5 65..230 CDD:239516 28/133 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.