DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and nudt8

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_017951395.1 Gene:nudt8 / 100487518 XenbaseID:XB-GENE-991700 Length:229 Species:Xenopus tropicalis


Alignment Length:206 Identity:71/206 - (34%)
Similarity:102/206 - (49%) Gaps:25/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QLLGPESQRRCMEKMRSLPAFPRPKALTPSRREKQTSAVLIALCQERGTNEISLLYTRRSRHLRS 112
            ::..||::|||.| :.|....| |.|         ::.||:.||..:|..  |.|||.||..||.
 Frog    26 KIFSPETERRCRE-ILSHTVLP-PVA---------SAGVLVTLCTFKGAP--SFLYTLRSPQLRG 77

  Fly   113 -HSFQISFPGGRRDDHDSSYVDCALRETEEEIGLPRHRIQVWGEAKQLQLPRTSSIVPV---VGV 173
             |...:|||||:||..|...:..|.||.|||:|:......|||..|.:.......||||   :|.
 Frog    78 RHKGDVSFPGGKRDSSDRDIIHTATREAEEELGISLKDNAVWGALKPITDWTGMVIVPVMANIGA 142

  Fly   174 VPDFSLSELRLNWEEVEEAFSVPLTSLMLPKATRHTQFRS----GYSGPVF-VVDHYRIWGITGY 233
            :.|.:|:.   |.:|||...::.|:...|..:..:|.||.    .|:.||| :...|::||:|..
 Frog   143 LEDLALNP---NRDEVESLLTLSLSVACLDASRGYTYFRQQGHYSYTLPVFRLTKGYKVWGLTAM 204

  Fly   234 LTHLFLHCLLP 244
            :|...|..|.|
 Frog   205 MTDSALSLLFP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 58/162 (36%)
nudt8XP_017951395.1 CoAse 51..207 CDD:239518 57/160 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10653
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41633
Inparanoid 1 1.050 94 1.000 Inparanoid score I4933
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253012at2759
OrthoFinder 1 1.000 - - FOG0001407
OrthoInspector 1 1.000 - - oto104184
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6507
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.