DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11095 and nudt7

DIOPT Version :9

Sequence 1:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_031756640.1 Gene:nudt7 / 100379717 XenbaseID:XB-GENE-966296 Length:251 Species:Xenopus tropicalis


Alignment Length:189 Identity:58/189 - (30%)
Similarity:82/189 - (43%) Gaps:47/189 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 QTSAVLIALCQERGTNEISLLYTRRSRHLRSHSFQISFPGGRRDDHDSSYVDCALRETEEEIGLP 146
            |.::||:.|..:.  .:|.||:|.||..|::....:.||||||:..|...|..||||.:|||||.
 Frog    55 QKASVLLPLFIKE--EKIHLLFTVRSMKLKTMPGDVCFPGGRREQTDKDDVQTALREAKEEIGLC 117

  Fly   147 RHRIQVWGEAKQLQLPRTSS-----IVPVVGVV-------PDFSLSELRLNWEEVEEAFSVPLTS 199
            ..::::.|..    :|..|.     |.|||.||       ||.:         ||.:.|.|||..
 Frog   118 PEQVEIIGRL----IPAMSMSPRYLITPVVAVVEEPFQACPDPN---------EVADVFLVPLDF 169

  Fly   200 LMLPKATRHTQFRSGYSGP------VFVVDHY---------RIWGITGYLTHLFLHCLL 243
            .:  .:..:|.......|.      .|   ||         :|||:|.:|..|....||
 Frog   170 FL--SSDHYTILHFNVPGTGTHRLHTF---HYEDKEKKKIFKIWGLTAHLALLLAVILL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11095NP_572927.1 CoAse 84..238 CDD:239518 54/180 (30%)
nudt7XP_031756640.1 CoAse 55..209 CDD:239518 51/173 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253012at2759
OrthoFinder 1 1.000 - - FOG0001407
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1771
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.