DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10993 and AT3G56510

DIOPT Version :9

Sequence 1:NP_572923.1 Gene:CG10993 / 32344 FlyBaseID:FBgn0030524 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001030873.1 Gene:AT3G56510 / 824818 AraportID:AT3G56510 Length:257 Species:Arabidopsis thaliana


Alignment Length:206 Identity:63/206 - (30%)
Similarity:93/206 - (45%) Gaps:47/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KEIKKKSKPKRKPTRMEVEESEPEMPFSYKTQPDEGESVNGEAHTSDDGDEMELATFKAASKKGV 66
            ||..|..|..||..:::                   |.:..||..:|:              :||
plant    20 KETMKSQKADRKKKKLK-------------------EKLLKEASKADN--------------RGV 51

  Fly    67 IYISNLPKHMTLTRLREILGEYGAIGRAFLRSQKLSRKPH--------NFLFAEGWVEFKSKRVA 123
            .|:|.:|.||...|||.||.:||.:||.:|..:....:.|        ...|:||||||..|.||
plant    52 CYLSRIPPHMDHVRLRHILAQYGELGRIYLAPEDSEAQVHRKRAGGFRGQRFSEGWVEFAKKSVA 116

  Fly   124 KQIVPLLNYKQISTHKKSPFYYSLWIMEYLPRFKWARLNELMNIVPVTNSQNHLKFLNKKAKKAK 188
            |::..:||.:||...|||..||.:|.::||.:|||..|.|.:........|. |..:...||:.|
plant   117 KRVADMLNGEQIGGKKKSSVYYDIWNIKYLTKFKWDDLTEEIAYKSAIREQK-LNMVLSAAKREK 180

  Fly   189 -----KVKKAK 194
                 |::|::
plant   181 DFYLSKIEKSR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10993NP_572923.1 RRM_ABT1_like 65..154 CDD:240709 40/96 (42%)
AT3G56510NP_001030873.1 RRM_ABT1_like 50..146 CDD:409707 39/95 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I1841
OMA 1 1.010 - - QHG56381
OrthoDB 1 1.010 - - D1377351at2759
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm3465
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1640
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.840

Return to query results.
Submit another query.