DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10993 and CG40813

DIOPT Version :9

Sequence 1:NP_572923.1 Gene:CG10993 / 32344 FlyBaseID:FBgn0030524 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001104071.2 Gene:CG40813 / 5740386 FlyBaseID:FBgn0085521 Length:213 Species:Drosophila melanogaster


Alignment Length:219 Identity:165/219 - (75%)
Similarity:178/219 - (81%) Gaps:15/219 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKEIKKKSKPKRKPTRMEVEESEPEMPFSYKTQPDEGESVNGEAHTSDDGDEMELATFKAAS--- 62
            |||||:|||||||||||||||.|.    |.|.||::|||.||||:.||:|||||||:||||.   
  Fly     1 MKEIKRKSKPKRKPTRMEVEEIET----SDKPQPEDGESANGEANPSDEGDEMELASFKAACSSS 61

  Fly    63 ------KKGVIYISNLPKHMTLTRLREILGEYGAIGRAFLRSQKLSRKPHNFLFAEGWVEFKSKR 121
                  |||:|||||:|||||||||||||||||.|||||||||  |.|.||.||||||||||||.
  Fly    62 DPAKKIKKGIIYISNIPKHMTLTRLREILGEYGGIGRAFLRSQ--SSKHHNILFAEGWVEFKSKH 124

  Fly   122 VAKQIVPLLNYKQISTHKKSPFYYSLWIMEYLPRFKWARLNELMNIVPVTNSQNHLKFLNKKAKK 186
            ||||:|.|||.|||||...||||||||.||||||||||||.||||.|.||||||||:||.||||:
  Fly   125 VAKQLVLLLNNKQISTRNNSPFYYSLWSMEYLPRFKWARLAELMNFVQVTNSQNHLEFLKKKAKE 189

  Fly   187 AKKVKKAKKALADRLLELVLASSI 210
            ||:||||.|.||||||||.|.|:|
  Fly   190 AKEVKKAMKVLADRLLELPLDSNI 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10993NP_572923.1 RRM_ABT1_like 65..154 CDD:240709 72/88 (82%)
CG40813NP_001104071.2 RRM_ABT1_like 75..157 CDD:240709 68/83 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136005
Inparanoid 1 1.050 134 1.000 Inparanoid score I1841
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D560584at33208
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm26593
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12311
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1640
99.000

Return to query results.
Submit another query.