DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10993 and Abt1

DIOPT Version :9

Sequence 1:NP_572923.1 Gene:CG10993 / 32344 FlyBaseID:FBgn0030524 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001020845.1 Gene:Abt1 / 306960 RGDID:1310785 Length:268 Species:Rattus norvegicus


Alignment Length:197 Identity:57/197 - (28%)
Similarity:98/197 - (49%) Gaps:42/197 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VEESEPEMPFSYKTQPDEGESVNGEAHTSDDGDEMELATFKAASKK---GVIYISNLPKHMTLTR 80
            |||.:..|        :|.:.||.||  :::.:|.|.|:...:.||   |::|:.::|.......
  Rat     8 VEEQKAAM--------EEEKEVNAEA--AEELEEAEEASCNGSKKKVVPGIVYLGHVPPRFRPLH 62

  Fly    81 LREILGEYGAIGRAFLRSQK--LSRK-------------PHNFLFAEGWVEFKSKRVAKQIVPLL 130
            :|.:|..||.:||.|.:::.  :.||             .::..:.||||||:.||:||::...|
  Rat    63 VRNLLSVYGEVGRVFFQAEDPFVRRKKKAAAAAGGKKGAKYSKDYTEGWVEFRDKRIAKRVAASL 127

  Fly   131 NYKQISTHKKSPFYYSLWIMEYLPRFKWARLNELMNIVPVTNSQNHLKFLN--KKAKKAKKVKKA 193
            :...:...|:|||.|.||.::||.||.|:.|:|            ||.|..  ::.:...:|.:|
  Rat   128 HNTPMGARKRSPFRYDLWNLKYLHRFTWSHLSE------------HLAFERQVRRQRLRAEVAQA 180

  Fly   194 KK 195
            |:
  Rat   181 KR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10993NP_572923.1 RRM_ABT1_like 65..154 CDD:240709 31/103 (30%)
Abt1NP_001020845.1 RRM_ABT1_like 47..151 CDD:240709 31/103 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..242
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340514
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I4546
OMA 1 1.010 - - QHG56381
OrthoDB 1 1.010 - - D1377351at2759
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm45062
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12311
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1640
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.870

Return to query results.
Submit another query.