DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10993 and ABT1

DIOPT Version :9

Sequence 1:NP_572923.1 Gene:CG10993 / 32344 FlyBaseID:FBgn0030524 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_037507.1 Gene:ABT1 / 29777 HGNCID:17369 Length:272 Species:Homo sapiens


Alignment Length:211 Identity:60/211 - (28%)
Similarity:97/211 - (45%) Gaps:42/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MEVEESEPEMPFSYKTQPDEGESVNGEAHTSDDGDEMELATFKAASKK-----GVIYISNLPKHM 76
            ||.||||        ....|.|.:.|...|.|..:|.|.:...|...|     |::|:.::|...
Human     1 MEAEESE--------KAATEQEPLEGTEQTLDAEEEQEESEEAACGSKKRVVPGIVYLGHIPPRF 57

  Fly    77 TLTRLREILGEYGAIGRAFL--------RSQKLS------RKPHNFLFAEGWVEFKSKRVAKQIV 127
            ....:|.:|..||.:||.|.        |.:|.:      ::.:...:.||||||:.||:||::.
Human    58 RPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKRVA 122

  Fly   128 PLLNYKQISTHKKSPFYYSLWIMEYLPRFKWARLNELMNIVPVTNSQNHLKFLNKKAKKAKKVKK 192
            ..|:...:...::|||.|.||.::||.||.|:.|:|            ||.| .::.::.:  .:
Human   123 ASLHNTPMGARRRSPFRYDLWNLKYLHRFTWSHLSE------------HLAF-ERQVRRQR--LR 172

  Fly   193 AKKALADRLLELVLAS 208
            |:.|.|.|..:..|.|
Human   173 AEVAQAKRETDFYLQS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10993NP_572923.1 RRM_ABT1_like 65..154 CDD:240709 30/102 (29%)
ABT1NP_037507.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 14/44 (32%)
RRM_ABT1_like 46..149 CDD:240709 30/102 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146860
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4581
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56381
OrthoDB 1 1.010 - - D1377351at2759
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm40925
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12311
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R417
SonicParanoid 1 1.000 - - X1640
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.