DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10993 and esf2

DIOPT Version :9

Sequence 1:NP_572923.1 Gene:CG10993 / 32344 FlyBaseID:FBgn0030524 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_595758.1 Gene:esf2 / 2540503 PomBaseID:SPBC28E12.05 Length:334 Species:Schizosaccharomyces pombe


Alignment Length:210 Identity:71/210 - (33%)
Similarity:110/210 - (52%) Gaps:24/210 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RKPTRMEVEESEPEMPFS--YKTQPDEGESVNGEAHTSDDGDEMELATFKAASKKGVIYISNLPK 74
            |:.:..|.|.|:.| .||  .:.:.||..:.|..:......:|:|... ||..:.||||:|.:|.
pombe    69 RRDSTFESETSDHE-DFSGGSENELDEETTKNANSIKKISLEEVEKQR-KAIKRSGVIYLSRIPP 131

  Fly    75 HMTLTRLREILGEYGAIGRAFL-------RSQKLSRKPHN--FLFAEGWVEFKSKRVAKQIVPLL 130
            :|...:||:||.:||.|||.:|       |:|:| |...|  .::.|||:||:||||||.:..||
pombe   132 YMAPNKLRQILSQYGKIGRVYLTPESSAKRAQRL-RNGGNKRVMYEEGWIEFESKRVAKSVAELL 195

  Fly   131 NYKQISTHKKSPFYYSLWIMEYLPRFKWARLNELMNI----------VPVTNSQNHLKFLNKKAK 185
            |..||...|.|.::..:|.|:|||:|||..|.|.:..          |.:...:..||...:..:
pombe   196 NTNQIGGKKSSWYHDDIWNMKYLPKFKWHHLTEQIAAENAARESRLKVEIEQGRKQLKQYMRNVE 260

  Fly   186 KAKKVKKAKKALADR 200
            .||.::..:|..::|
pombe   261 NAKMIEGIRKKRSER 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10993NP_572923.1 RRM_ABT1_like 65..154 CDD:240709 43/97 (44%)
esf2NP_595758.1 RRM_ABT1_like 122..219 CDD:240709 43/97 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1255
OMA 1 1.010 - - QHG56381
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm47170
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12311
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R417
SonicParanoid 1 1.000 - - X1640
TreeFam 1 0.960 - -
1110.960

Return to query results.
Submit another query.