DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10993 and F57B10.8

DIOPT Version :9

Sequence 1:NP_572923.1 Gene:CG10993 / 32344 FlyBaseID:FBgn0030524 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_491887.1 Gene:F57B10.8 / 172368 WormBaseID:WBGene00019005 Length:268 Species:Caenorhabditis elegans


Alignment Length:249 Identity:73/249 - (29%)
Similarity:106/249 - (42%) Gaps:62/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKKSKPKRKPTR-------MEVEESEPEM----PFSYKTQPDEGESVN---GEAHTSDDGDEMEL 55
            |||.|..||..:       |::|| |.||    ..|.:|..:|.|:.|   .|..|.:..|: |:
 Worm     6 KKKKKIVRKSIKKPVVEEDMKMEE-EKEMLEPKEESIETDNNEDEAGNLDDSEIKTEESEDD-EM 68

  Fly    56 ATFKAASKK----GVIYISNLPKHMTLTRLREILGEY--GAIGRAFLRSQKLSRKPHNFLFAEGW 114
            .||:...:|    ||::.|.:|....:.|:||...:.  |.:||.||...|.|:.| .:|::|||
 Worm    69 ETFEDPEQKQKKTGVVFFSTIPPKYNVVRMREYFEKRCPGQVGRIFLARNKHSKNP-QYLYSEGW 132

  Fly   115 VEFKSKRVAKQIVPLLNYKQISTHKKSPFYYSLWIMEYLPRFKWARLNELMNI----------VP 169
            :|.|.|::||.|...::...|....|.|....||.:.||..|||..|.|.:..          |.
 Worm   133 MELKKKKIAKAIAEQIDNTPIGGKNKDPVSSMLWNIRYLSGFKWVHLMEQLQYEKEVEKRRMNVE 197

  Fly   170 VTNSQ-------------NHLKFLNKKA----------------KKAKKVKKAK 194
            |..::             .||:.|..|.                ||..||||.:
 Worm   198 VAQARRIAAHFEEQIEKGKHLRKLEAKVTASGGKWDKFQRDVQQKKVVKVKKER 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10993NP_572923.1 RRM_ABT1_like 65..154 CDD:240709 31/90 (34%)
F57B10.8NP_491887.1 RRM_SF 82..172 CDD:302621 31/90 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159071
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I3295
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56381
OrthoDB 1 1.010 - - D1377351at2759
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm14709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12311
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R417
SonicParanoid 1 1.000 - - X1640
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.900

Return to query results.
Submit another query.