DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10993 and abt1

DIOPT Version :9

Sequence 1:NP_572923.1 Gene:CG10993 / 32344 FlyBaseID:FBgn0030524 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001234912.2 Gene:abt1 / 100145601 XenbaseID:XB-GENE-5916363 Length:276 Species:Xenopus tropicalis


Alignment Length:207 Identity:58/207 - (28%)
Similarity:100/207 - (48%) Gaps:34/207 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKSKPKRKPTRMEVEESEPEMPFSYKTQPDEGESVNGEAHTSDDGDEMELATFKAASKKGVIYIS 70
            |::..:::|.....|..|.|.|               |..|::|.::..|...:..  .|:||:.
 Frog     5 KEAAEEQEPMGQGEESMEEEEP---------------ERETAEDEEKGSLGGKRVV--PGIIYLG 52

  Fly    71 NLPKHMTLTRLREILGEYGAIGRAFLRS-QKLSRKPHNFL------FAEGWVEFKSKRVAKQIVP 128
            ::|..:....:|.:|..:|.:||.||:: ::..||.....      |.||||||:.|||||.:..
 Frog    53 HIPPRLRPRHIRNMLSGHGEVGRIFLQAEERFVRKKKKKAGTNAKDFTEGWVEFRDKRVAKLVAA 117

  Fly   129 LLNYKQISTHKKSPFYYSLWIMEYLPRFKWARLNELMNI----------VPVTNSQNHLKFLNKK 183
            .||...:.|.||:.|:..||.|:||.||||:.|:|.:.:          ..|:.::....|..:.
 Frog   118 SLNSAPMGTRKKNRFHDDLWNMKYLHRFKWSHLSERLALERQVRQQRMRAEVSQAKRETNFYLQN 182

  Fly   184 AKKAKKVKKAKK 195
            .:::||..||::
 Frog   183 VERSKKFSKAER 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10993NP_572923.1 RRM_ABT1_like 65..154 CDD:240709 35/95 (37%)
abt1NP_001234912.2 RRM_ABT1_like 47..143 CDD:240709 35/95 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5103
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm48122
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1640
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.