DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaE and LOC100486956

DIOPT Version :9

Sequence 1:NP_001138195.1 Gene:inaE / 32343 FlyBaseID:FBgn0261244 Length:1318 Species:Drosophila melanogaster
Sequence 2:XP_031756406.1 Gene:LOC100486956 / 100486956 -ID:- Length:150 Species:Xenopus tropicalis


Alignment Length:125 Identity:55/125 - (44%)
Similarity:72/125 - (57%) Gaps:0/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPGLVVFRRRWSVGSDDLVVPGAFLLTIHFICFVIVSVSLVIFEYNTRILSVKLLFYHLIGYLLI 65
            |||:||.|.||||||||||:||.||..:|...|||:||.|....||........|..|..|||.|
 Frog     1 MPGIVVCRCRWSVGSDDLVLPGIFLFVLHSTWFVILSVVLFGLTYNPHETCSLNLVDHGRGYLGI 65

  Fly    66 LFFSICVEIGICVISMRGSILDAEARTSINIWIYLKSLVILFDIAWLAVGSVWLGHYYTT 125
            |...:..|:.|..:||||.||..|.|.|:...:|:...:::.:..:..:|.|||..|||:
 Frog    66 LLSCMIAEMAIIWLSMRGGILYTEPRDSMQYVLYVCLAILVIEFIYAIMGIVWLAQYYTS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaENP_001138195.1 Lipase_3 300..542 CDD:238287
LOC100486956XP_031756406.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D191418at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.