DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11103 and TM2D2

DIOPT Version :9

Sequence 1:NP_001033842.2 Gene:CG11103 / 32342 FlyBaseID:FBgn0030522 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_510882.1 Gene:TM2D2 / 83877 HGNCID:24127 Length:214 Species:Homo sapiens


Alignment Length:215 Identity:104/215 - (48%)
Similarity:129/215 - (60%) Gaps:30/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLAFLVARQHDAQAIQARSDKEQPQTVVSGTAVQSVVPVQAQLGSGMGPSSSSSSASSASGGAGN 71
            ||...|:|.|...|      ..:|:...:|.|...            ||           |||.:
Human    25 LLLHCVSRSHSQNA------TAEPELTSAGAAQPE------------GP-----------GGAAS 60

  Fly    72 SAF-YPLGPNVMCSFLPRDFLDCKDPVDHRENATAQQEKKYGCLKFGGSTYEEVEHAMVWCTVFA 135
            ..: .|..|.::||:||.:|::|:|||||..||||.||..||||||||..|.:|||..|.|....
Human    61 WEYGDPHSPVILCSYLPDEFIECEDPVDHVGNATASQELGYGCLKFGGQAYSDVEHTSVQCHALD 125

  Fly   136 DIECYGNRTFLRAGVPCVRYTDHYFVTTLIYSMLLGFLGMDRFCLGQTGTAVGKLLTMGGVGVWW 200
            .|||...|||||...||::||.|||:|||:||..||..|:||||||.||||||||||:||:|:||
Human   126 GIECASPRTFLRENKPCIKYTGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWW 190

  Fly   201 IIDVILLITNNLLPEDGSNW 220
            .:|:|||||..|:|.|||||
Human   191 FVDLILLITGGLMPSDGSNW 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11103NP_001033842.2 TM2 156..205 CDD:377473 34/48 (71%)
TM2D2NP_510882.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..59 7/41 (17%)
TM2 146..195 CDD:377473 34/48 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140815
Domainoid 1 1.000 109 1.000 Domainoid score I6389
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12328
Inparanoid 1 1.050 213 1.000 Inparanoid score I3645
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57548
OrthoDB 1 1.010 - - D1278556at2759
OrthoFinder 1 1.000 - - FOG0007509
OrthoInspector 1 1.000 - - oto89815
orthoMCL 1 0.900 - - OOG6_107239
Panther 1 1.100 - - LDO PTHR21016
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2846
SonicParanoid 1 1.000 - - X5640
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.