DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11103 and Tm2d3

DIOPT Version :9

Sequence 1:NP_001033842.2 Gene:CG11103 / 32342 FlyBaseID:FBgn0030522 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_835157.1 Gene:Tm2d3 / 68634 MGIID:1915884 Length:261 Species:Mus musculus


Alignment Length:248 Identity:68/248 - (27%)
Similarity:94/248 - (37%) Gaps:69/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QHDAQAIQARSDKEQPQTVVSGTAVQSVVP--VQAQLGSGMGPSSSSSSASSASGGAGNSAFYPL 77
            :|.....||..|....:|.       ||||  .:.||.|.:..|:......:.....|       
Mouse    36 EHSQPLAQAIKDPGPTRTF-------SVVPRAAENQLFSHLTESTEIPPYMTKCPSNG------- 86

  Fly    78 GPNVMCSFLPRDFLDC--------------------------KDPVDHRE---NATAQ-----QE 108
                :||.||.|.::|                          :|....|.   |.|.:     .|
Mouse    87 ----LCSRLPADCIECATNVSCTYGKPVTFDCTVKPSVTCVDQDLKPQRNFVINMTCRFCWQLPE 147

  Fly   109 KKYGCLKFGGSTYEEV----EHAMVWCTVFADIECYGNRTFLRAGVPCVRYTD----HYFVTTLI 165
            ..|.|  ...:|...|    :.....|||...|.|.|||||     |.:.|.:    :.:.|.|.
Mouse   148 TDYEC--SNSTTCMTVACPRQRYFANCTVRDHIHCLGNRTF-----PKLLYCNWTGGYKWSTALA 205

  Fly   166 YSMLLGFLGMDRFCLGQTGTAVGKLLTMGGVGVWWIIDVILLITNNLLPEDGS 218
            .|:.||..|.|||.|||....:|||.:.||:|:|.:|||:|:....:.|.|||
Mouse   206 LSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11103NP_001033842.2 TM2 156..205 CDD:377473 21/52 (40%)
Tm2d3NP_835157.1 TM2 196..245 CDD:282945 21/48 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.