DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11103 and Tm2d1

DIOPT Version :9

Sequence 1:NP_001033842.2 Gene:CG11103 / 32342 FlyBaseID:FBgn0030522 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001102140.1 Gene:Tm2d1 / 362545 RGDID:1305442 Length:208 Species:Rattus norvegicus


Alignment Length:178 Identity:44/178 - (24%)
Similarity:68/178 - (38%) Gaps:50/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SSASGGAGNSAFYPLGPNVMCSFLPRDFLDCKDPVDHRENATAQQEKKYGCLKFGGSTYEEVEHA 127
            ::|||..|..      ....|..|......||:|                  |...:|.|.|.  
  Rat    35 AAASGAVGGE------ETPKCEDLRVGQYICKEP------------------KINDATQEPVN-- 73

  Fly   128 MVWCTVF-ADIECY-----------GNRT--------FLRAGVPCVRYTDHYFVTTLIYSMLLGF 172
               ||.: |.::|:           ||.|        ||:. :.|.....:.:...:..|:.||:
  Rat    74 ---CTNYTAHVQCFPAPNITCKDLSGNETHFTGSEVGFLKP-ISCRNVNGYSYKVAVALSLFLGW 134

  Fly   173 LGMDRFCLGQTGTAVGKLLTMGGVGVWWIIDVILLITNNLLPEDGSNW 220
            ||.|||.||.....:.|..|:|..|:..:||.:|:....:.|.|||::
  Rat   135 LGADRFYLGYPALGLLKFCTVGFCGIGSLIDFVLISMQIVGPSDGSSY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11103NP_001033842.2 TM2 156..205 CDD:377473 16/48 (33%)
Tm2d1NP_001102140.1 TM2 118..167 CDD:377473 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.