DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11103 and C02F5.13

DIOPT Version :9

Sequence 1:NP_001033842.2 Gene:CG11103 / 32342 FlyBaseID:FBgn0030522 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001021138.1 Gene:C02F5.13 / 3565859 WormBaseID:WBGene00015353 Length:210 Species:Caenorhabditis elegans


Alignment Length:163 Identity:79/163 - (48%)
Similarity:100/163 - (61%) Gaps:16/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 FY----PLGPNVMCSFLPRDFLDCKDPVD-HRENATAQQ--------EKKYGCLKFGGSTYEEVE 125
            ||    ||||.|.|.||...|:.|:|||. :....|.||        |.|  |||.||...|:||
 Worm    50 FYVSTNPLGPVVECRFLENSFILCEDPVPLYGPGQTGQQPANESFRNEGK--CLKMGGYRAEDVE 112

  Fly   126 HAMVWCTVFADIECYGNRTFLRAGVPCVRYTDHYFVTTLIYSMLLGFLGMDRFCLGQTGTAVGKL 190
            ...|.|.|...|||:|.|||.:: .||:.|..|||:|||:||:.||.:.:||||||.:..|||||
 Worm   113 FTNVKCRVLPCIECHGPRTFTKS-TPCIIYNGHYFLTTLLYSIFLGVVAVDRFCLGYSAMAVGKL 176

  Fly   191 LTMGGVGVWWIIDVILLITNNLLPEDGSNWNPY 223
            :|:||.|:|||:|:.||:...|.|.|.|:|.||
 Worm   177 MTLGGFGIWWIVDIFLLVLGVLGPADDSSWEPY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11103NP_001033842.2 TM2 156..205 CDD:377473 29/48 (60%)
C02F5.13NP_001021138.1 TM2 142..191 CDD:282945 29/48 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156143
Domainoid 1 1.000 76 1.000 Domainoid score I5868
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12328
Inparanoid 1 1.050 152 1.000 Inparanoid score I2952
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57548
OrthoDB 1 1.010 - - D1278556at2759
OrthoFinder 1 1.000 - - FOG0007509
OrthoInspector 1 1.000 - - oto18988
orthoMCL 1 0.900 - - OOG6_107239
Panther 1 1.100 - - LDO PTHR21016
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2846
SonicParanoid 1 1.000 - - X5640
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.