DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Tinagl1

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001161805.1 Gene:Tinagl1 / 94242 MGIID:2137617 Length:466 Species:Mus musculus


Alignment Length:336 Identity:108/336 - (32%)
Similarity:159/336 - (47%) Gaps:43/336 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EPSLLSDEFIEVVRSKAKTWTVGRN---FDASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYV 81
            ||.|:..:.|:.:......|..|.:   :..::.||...||..:.|.:....:.:...|||...|
Mouse   137 EPCLVDPDMIKAINRGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSTVMNMNEIYTVLGQGEV 201

  Fly    82 NSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLV 146
                 ||..|::.::|||  .|.|..|||:|...|||......||||.|||.|.:....|..:|:
Mouse   202 -----LPTAFEASEKWPN--LIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPILSPQNLL 259

  Fly   147 SCCHTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPC-----AH 206
            ||......||.||....||.:..|:|:||       ..|.|:  |..|.:.....|.|     |.
Mouse   260 SCDTHHQQGCRGGRLDGAWWFLRRRGVVS-------DNCYPF--SGREQNEASPTPRCMMHSRAM 315

  Fly   207 GGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDG 271
            |....:.:..|.:| .|| :.|.:..:.:|.:..:.:||.:|:|.||||:....|:||..||:.|
Mouse   316 GRGKRQATSRCPNG-QVD-SNDIYQVTPAYRLGSDEKEIMKELMENGPVQALMEVHEDFFLYQRG 378

  Fly   272 VYQH--------EHGKELGGHAIRILGWGVWGEEKIP------YWLIGNSWNTDWGDHGFFRILR 322
            :|.|        |..:..|.|:::|.|   ||||.:|      ||...|||...||:.|.|||:|
Mouse   379 IYSHTPVSQGRPEQYRRHGTHSVKITG---WGEETLPDGRTIKYWTAANSWGPWWGERGHFRIVR 440

  Fly   323 GQDHCGIESSI 333
            |.:.|.||:.:
Mouse   441 GTNECDIETFV 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 8/42 (19%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 92/265 (35%)
Tinagl1NP_001161805.1 Somatomedin_B 53..93 CDD:279385
VWC 104..>152 CDD:302663 4/14 (29%)
Peptidase_C1A_CathepsinB 203..454 CDD:239111 92/265 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.