DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CTSF

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_003784.2 Gene:CTSF / 8722 HGNCID:2531 Length:484 Species:Homo sapiens


Alignment Length:373 Identity:81/373 - (21%)
Similarity:143/373 - (38%) Gaps:96/373 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TAASVAALTSGEPSLLSDEFIEVVRSKAKTW--TVGRNFDASVTEGHIRRLMGVH--PDAHKFAL 69
            |.:||.:|.:.:|  ||.:....:.|..|.:  |..|.:: |..|...|..:.|:  ..|.|...
Human   162 TFSSVISLLNEDP--LSQDLPVKMASIFKNFVITYNRTYE-SKEEARWRLSVFVNNMVRAQKIQA 223

  Fly    70 PDK--------------REVLGDLYVNSV----------------DELPEEFDSRKQWPNCPTIG 104
            .|:              .|....:|:|::                |..|.|:|    |.:...:.
Human   224 LDRGTAQYGVTKFSDLTEEEFRTIYLNTLLRKEPGNKMKQAKSVGDLAPPEWD----WRSKGAVT 284

  Fly   105 EIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFGCNGGFPGAAWSYWT 169
            :::|||.|||||||.....:..:..::.|..::  .|..:|:. |......|.||.|..|:|...
Human   285 KVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLS--LSEQELLD-CDKMDKACMGGLPSNAYSAIK 346

  Fly   170 RKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVDYAKDKHFGSK 234
            ..|.:.                        |....::.|....|:...:        |.|.:.:.
Human   347 NLGGLE------------------------TEDDYSYQGHMQSCNFSAE--------KAKVYIND 379

  Fly   235 SYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHEHGKE----------LGGHAIRIL 289
            |..:.:|.:::...:...||:..|...:        |:..:.||..          |..||:.::
Human   380 SVELSQNEQKLAAWLAKRGPISVAINAF--------GMQFYRHGISRPLRPLCSPWLIDHAVLLV 436

  Fly   290 GWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSISAGL 337
            |:|  ....:|:|.|.|||.||||:.|::.:.||...||:.:..|:.:
Human   437 GYG--NRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAV 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 10/43 (23%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 59/257 (23%)
CTSFNP_003784.2 Inhibitor_I29 187..243 CDD:214853 10/56 (18%)
Peptidase_C1 271..482 CDD:278538 59/259 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.