DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and RD21A

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_564497.1 Gene:RD21A / 841122 AraportID:AT1G47128 Length:462 Species:Arabidopsis thaliana


Alignment Length:258 Identity:73/258 - (28%)
Similarity:115/258 - (44%) Gaps:61/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAF---GAVEAMSDRVCIHSGGKVNFHFSADDLV 146
            |||||..|.||:    ..:.|::|||.|||||||   ||||.::.   |.:|..:.  .|..:||
plant   135 DELPESIDWRKK----GAVAEVKDQGGCGSCWAFSTIGAVEGINQ---IVTGDLIT--LSEQELV 190

  Fly   147 SCCHTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTP 211
            .|..:...|||||....|:.:     |:..|...:::. .||:      .|:||           
plant   191 DCDTSYNEGCNGGLMDYAFEF-----IIKNGGIDTDKD-YPYK------GVDGT----------- 232

  Fly   212 KCSHVCQSG--YTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGP----VEGAFTVYEDLILYKD 270
             |..:.::.  .|:|..:|    ..:||     .|..::.:.:.|    :|.....::   ||..
plant   233 -CDQIRKNAKVVTIDSYED----VPTYS-----EESLKKAVAHQPISIAIEAGGRAFQ---LYDS 284

  Fly   271 GVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILR----GQDHCGI 329
            |::....|.:| .|.:..:|:|.  |....||::.|||...||:.|:.|:.|    ....|||
plant   285 GIFDGSCGTQL-DHGVVAVGYGT--ENGKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 70/255 (27%)
RD21ANP_564497.1 Inhibitor_I29 50..107 CDD:214853
Peptidase_C1 137..352 CDD:395062 71/256 (28%)
GRAN 376..432 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.