DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT1G29110

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_564322.1 Gene:AT1G29110 / 839786 AraportID:AT1G29110 Length:334 Species:Arabidopsis thaliana


Alignment Length:330 Identity:78/330 - (23%)
Similarity:115/330 - (34%) Gaps:98/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EFIEVVRSKA-KTWTVGRNFDASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVNSVDELPEE 90
            :|||...:.. :::|:|.|   ..|:......:..|.               .|.|| |..|.|.
plant    67 KFIENFNNMGNQSYTLGVN---EFTDWKTEEF
LATHT---------------GLRVN-VTSLSEL 112

  Fly    91 F-----------------DSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNF 138
            |                 |..|.|.:...:..::.||:|              |:...| ||...
plant   113 FNKTKPSRNWNMSDIDMEDESKDWRDEGAVTPVKYQGAC--------------RLTKIS-GKNLL 162

  Fly   139 HFSADDLVSCCHTCGFGCNGGFPGAAWSYWTRKGIVS-GGPYGSNQGCRPYEISPCEHHVNGTRP 202
            ..|...|:.|......|||||....|:.|..:.|.|| ...|       ||::.......|..|.
plant   163 TLSEQQLIDCDIEKNGGCNGGEFEEAFKYIIKNGGVSLETEY-------PYQVKKESCRANARRA 220

  Fly   203 PCAHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLI- 266
            |           |....|:.:         ..|::.|..:..::.:     ||........|.. 
plant   221 P-----------HTQIRGFQM---------VPSHNERALLEAVRRQ-----PVSVLIDARADSFG 260

  Fly   267 LYKDGVYQHEHGKELG---GHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRG----Q 324
            .||.|||.   |.:.|   .||:.|:|:|..  ..:.||::.|||...||::|:.||.|.    |
plant   261 HYKGGVYA---GLDCGTDVNHAVTIVGYGTM--SGLNYWVLKNSWGESWGENGYMRIRRDVEWPQ 320

  Fly   325 DHCGI 329
            ..|||
plant   321 GMCGI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 8/37 (22%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 65/268 (24%)
AT1G29110NP_564322.1 Inhibitor_I29 38..95 CDD:285458 7/30 (23%)
Peptidase_C1 132..333 CDD:278538 62/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.