DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and XCP2

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_564126.1 Gene:XCP2 / 838677 AraportID:AT1G20850 Length:356 Species:Arabidopsis thaliana


Alignment Length:320 Identity:74/320 - (23%)
Similarity:123/320 - (38%) Gaps:65/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IEVVRSKAKTWTVGRNFDASVTEGHIRRL-MGVHPDAHKFALPDKREVLGDLYVNSVDELPEEFD 92
            |:....|.|::.:|.|..|.::....::: :|:..|   ....|:.....:.....|:.:|:..|
plant    82 IDETNKKGKSYWLGLNEFADLSHEE
FKKMYLGLKTD---IVRRDEERSYAEFAYRDVEAVPKSVD 143

  Fly    93 SRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFGCN 157
            .||:    ..:.|:::||||||||||..|.|:.....|.:|....  .|..:|:.|..|...|||
plant   144 WRKK----GAVAEVKNQGSCGSCWAFSTVAAVEGINKIVTGNLTT--LSEQELIDCDTTYNNGCN 202

  Fly   158 GGFPGAAWSYWTRKGIVSGG--------PYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCS 214
            ||....|:.|     ||..|        ||...:|       .||...:.:.....:|.:     
plant   203 GGLMDYAFEY-----IVKNGGLRKEEDYPYSMEEG-------TCEMQKDESETVTINGHQ----- 250

  Fly   215 HVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVY-EDLILYKDGVYQHEHG 278
                                  .|..|..:...:.:.:.|:..|.... .:...|..||:....|
plant   251 ----------------------DVPTNDEKSLLKALAHQPLSVAIDASGREFQFYSGGVFDGRCG 293

  Fly   279 KELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRG----QDHCGIESSIS 334
            .:| .|.:..:|:|  ..:...|.::.|||...||:.|:.|:.|.    :..|||....|
plant   294 VDL-DHGVAAVGYG--SSKGSDYIIVKNSWGPKWGEKGYIRLKRNTGKPEGLCGINKMAS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/35 (20%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 64/260 (25%)
XCP2NP_564126.1 Inhibitor_I29 51..106 CDD:214853 6/23 (26%)
Peptidase_C1 138..353 CDD:395062 64/261 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.