DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and XBCP3

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_563855.1 Gene:XBCP3 / 837517 AraportID:AT1G09850 Length:437 Species:Arabidopsis thaliana


Alignment Length:306 Identity:81/306 - (26%)
Similarity:128/306 - (41%) Gaps:67/306 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TWTVGRNFDASVTEGHIR-RLMGVHPDAHKFALPDKREVLGDLYVNSVDELPEEFDSRKQWPNCP 101
            |:::..|..|.:|....: ..:|:...|....:..|.:.||    .|| ::|:..|.||:    .
plant    73 TYSLSLNAFADLTHHEF
KASRLGLSVSAPSVIMASKGQSLG----GSV-KVPDSVDWRKK----G 128

  Fly   102 TIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFGCNGGFPGAAWS 166
            .:..::||||||:||:|.|..||.....|.:|..::  .|..:|:.|..:...|||||....|:.
plant   129 AVTNVKDQGSCGACWSFSATGAMEGINQIVTGDLIS--LSEQELIDCDKSYNAGCNGGLMDYAFE 191

  Fly   167 YWTRK-GIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVDYAKDKH 230
            :..:. ||.:...|       ||:      ..:||                |:.    |..|.|.
plant   192 FVIKNHGIDTEKDY-------PYQ------ERDGT----------------CKK----DKLKQKV 223

  Fly   231 FGSKSYS-VRRNVREIQEEIMTNGPV-------EGAFTVYEDLILYKDGVYQHEHGKELGGHAIR 287
            ....||: |:.|..:...|.:...||       |.||.      ||..|::.......| .||:.
plant   224 VTIDSYAGVKSNDEKALMEAVAAQPVSVGICGSERAFQ------LYSSGIFSGPCSTSL-DHAVL 281

  Fly   288 ILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH----CGI 329
            |:|:|  .:..:.||::.|||...||..||..:.|..::    |||
plant   282 IVGYG--SQNGVDYWIVKNSWGKSWGMDGFMHMQRNTENSDGVCGI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 5/26 (19%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 70/255 (27%)
XBCP3NP_563855.1 Inhibitor_I29 32..89 CDD:285458 4/15 (27%)
Peptidase_C1 118..333 CDD:278538 70/256 (27%)
GRAN 351..407 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.